PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA007643-PA
Common NameOsI_06048
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family SBP
Protein Properties Length: 322aa    MW: 35270.5 Da    PI: 9.3859
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA007643-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP125.32.6e-3963140178
                       --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
               SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       +CqvegC ++l  +k+yhr+h+vCe+hsk p v+v+g+e+rfCqqCsrfh+lsefD++krsCrrrL +hn+rrrk+q+
  BGIOSGA007643-PA  63 RCQVEGCGVELVGVKDYHRKHRVCEAHSKFPRVVVAGQERRFCQQCSRFHALSEFDQKKRSCRRRLYDHNARRRKPQT 140
                       6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.9E-3356125IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.66761138IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-3862144IPR004333Transcription factor, SBP-box
PfamPF031101.5E-3064137IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MDWMPPPKPT SPRSPPLLWD WADAAVPGSS SGEVSAAAAH PGRRRKEKRG RAEEGGGGGG  60
EVRCQVEGCG VELVGVKDYH RKHRVCEAHS KFPRVVVAGQ ERRFCQQCSR FHALSEFDQK  120
KRSCRRRLYD HNARRRKPQT DVFSYASARP PSSLLFDDNR QISFVWNKAP LSHVRPFAIS  180
PWESSSEVGT TDGHIYLDKS HISKSLPAFN TDIDELLPMK GPDASLTASK FDGAPDLQRA  240
LSLLSSSSCG LPDPVQQASR VIQFTGASQN NRELPPLNGG NSASASCANV QTIAQPAQLV  300
RFTMNASSNA CQSNFFGLNQ IN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-2457137484squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14247RRRKEK
2119136KKRSCRRRLYDHNARRRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.513670.0callus| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329787190.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8287410.0CT828741.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA126O04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623076.10.0PREDICTED: squamosa promoter-binding-like protein 4 isoform X2
SwissprotQ6H5091e-143SPL4_ORYSJ; Squamosa promoter-binding-like protein 4
TrEMBLA2X1G60.0A2X1G6_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA007643-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.39e-38squamosa promoter binding protein-like 2